PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10018518
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 270aa    MW: 29604.7 Da    PI: 6.6578
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10018518genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.25.8e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd++l  +++++G  +W+  ++  g+ R++k+c++rw +yl
      Lus10018518 14 KGAWSKEEDDKLRAYIARYGHCNWRELPKFAGLSRCGKSCRLRWINYL 61
                     79********************************************97 PP

2Myb_DNA-binding49.31.1e-1568111247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g +T+eEd l+ d+ +qlG++ W+tIa+++  gRt++++k++w+ +
      Lus10018518  68 GGFTPEEDRLITDLRQQLGNK-WSTIASKIS-GRTDNEIKNYWHAH 111
                      569******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.835965IPR017930Myb domain
SuperFamilySSF466899.9E-3011108IPR009057Homeodomain-like
SMARTSM007171.0E-131363IPR001005SANT/Myb domain
PfamPF002491.4E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-231567IPR009057Homeodomain-like
CDDcd001671.42E-101661No hitNo description
PROSITE profilePS5129417.13666116IPR017930Myb domain
SMARTSM007171.1E-1366114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-2468116IPR009057Homeodomain-like
PfamPF002491.1E-1268111IPR001005SANT/Myb domain
CDDcd001678.59E-1070112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MVRGAFYDKN GVKKGAWSKE EDDKLRAYIA RYGHCNWREL PKFAGLSRCG KSCRLRWINY  60
LRPDLKHGGF TPEEDRLITD LRQQLGNKWS TIASKISGRT DNEIKNYWHA HLKKRVTTEQ  120
RTPAGQSQSS NKSSPPTSSC SSDLQNSGSQ SQCQTSQVLK ETLKILESSP LSPPETSSYA  180
SGGESSAAAV GRRENCTIDG DSNSGGCCHY DDGGDFWTEP FVVESSISSG GGGSSGDLPM  240
WWMGGESMTW PDEFLLDNDD AKDVLVKLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-25141187110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002325682.14e-70hypothetical protein POPTR_0019s14130g
RefseqXP_006447414.12e-70hypothetical protein CICLE_v10017677mg
RefseqXP_006469811.22e-70PREDICTED: myb-related protein Myb4-like
TrEMBLA0A067EY031e-71A0A067EY03_CITSI; Uncharacterized protein
STRINGPOPTR_0019s14130.11e-69(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.15e-51myb domain protein 14